LL-37 is the only human cathelicidin antimicrobial peptide, cleaved from the C-terminal of hCAP-18 precursor in neutrophils, macrophages, and epithelial cells. This α-helical, cationic peptide exhibits broad-spectrum activity against bacteria, viruses, fungi, and biofilms while modulating immune responses (chemotaxis, cytokine regulation, wound closure). Discovered in the 1990s, it is a cornerstone for innate defense and inflammation research. This research-grade lyophilized powder is synthesized under strict quality controls and provided with full analytical documentation.
Key Scientific
- High-purity LL-37 (≥ 99% by HPLC/MS, acetate salt form)
- Verified 37-amino-acid sequence: [LL-37, 37 aa]
- Lyophilized formulation for maximum long-term stability
- Full Certificate of Analysis (COA) with HPLC, MS, amino acid analysis, and antimicrobial assay
- Manufactured in GMP-aligned, ISO-compliant facilities
- Ideal for innate immunity, biofilm disruption, and epithelial barrier studies
Research-Referenced Attributes (Based on scientific literature; not intended as therapeutic claims.)
- Broad antimicrobial spectrum: disrupts gram-positive/negative bacterial membranes, eradicates biofilms
- Promotes wound healing: ↑ re-epithelialization, angiogenesis, and collagen deposition
- Modulates inflammation: chemotaxis of immune cells, cytokine regulation (↑ IL-8, ↓ excess TNF-α)
- Immunomodulatory in chronic conditions (psoriasis, lupus, arthritis models)
- Potential antiviral (enveloped viruses) and anti-cancer effects via membrane targeting
- Valuable in infection, inflammation, wound, and autoimmune disease research
Why Researchers Choose Nationwide Peptides LL-37
- Exact human cathelicidin sequence used in landmark antimicrobial studies
- Highest documented membrane-disrupting potency among research suppliers
- Transparent analytical data (HPLC >99%, MS confirmation)
- Trusted by immunology, microbiology, and wound-healing laboratories worldwide
- Competitive research pricing with bulk options